PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 352aa    MW: 39106 Da    PI: 6.2971
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57379.64.8e-2548142297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +f+r+w+e Dei +LqGl+d+ +++      d+  fy  +++ +s  ++ksql+eK+rrL+kKf+  +++ ++g ++s  + hd+  ++lsk++W
  XP_011097448.1  48 KFHRIWTEPDEIRFLQGLLDCSSQHL-AFPRDLGIFYARFSNTMSQPYTKSQLSEKLRRLRKKFRVISTRLSKGLDQSQLSLHDRALYDLSKQLW 141
                     699******************77665.6677**************************************************************** PP

          DUF573  97 g 97 
                     +
  XP_011097448.1 142 H 142
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.7E-2849142IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDSTLIQPHH HKPSASKLPI KRKTPDPNPL PPPDASPDTI DGRAPPFKFH RIWTEPDEIR  60
FLQGLLDCSS QHLAFPRDLG IFYARFSNTM SQPYTKSQLS EKLRRLRKKF RVISTRLSKG  120
LDQSQLSLHD RALYDLSKQL WHPEYAATSP FSGARNVGLN HSSNTVVGGY VDGKLKKSSL  180
VGIKVDFSPT LQAITSGFDQ ENDANLELDS VQNENGGGDE GGVAVGDIYV EDNRNEEVKL  240
SEVNVEFEGE EEAMEDEGHD TFGGGIGAVK VVAGQSIDSD CKNKIGEVAA KVVMNVFDEC  300
FKDVKRKLLV GRVGERVGVE SFQVRWQQQM IAELDVLGSR LRLALEHSLQ KH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097448.10.0PREDICTED: uncharacterized protein LOC105176365
TrEMBLA0A022RZ511e-129A0A022RZ51_ERYGU; Uncharacterized protein
STRINGSolyc05g051330.1.14e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128221921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.12e-17DNA-binding storekeeper protein-related transcriptional regulator